Structure of PDB 4v7e Chain CE

Receptor sequence

>4v7eCE (length=219) Species: 4565 (Triticum aestivum) [Search protein sequence]

MAPTSKMALGIKRASRSHTYHRRGLWAIKAKHGGALPKAEKPAAIAEPKF
YPADDVKPRTVSTRKPHPTKLRSTITPGTVLILLAGRYMGKRVVFLKQLQ
SGLLLITGPFKINGVPIRRVNQAYVIATSTKVDISKVNVQKFDDKYFARE
KKTRAKKTEGELFESDKEATKNLPDFKKDDQKVIDAELIKAIDAVPDLKN
YLGARFSLRDGDKPHEMTF

3D structure

PDB

4v7e Structures of the Sec61 complex engaged in nascent peptide translocation or membrane insertion.

Chain

Resolution

5.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CE	M1 A2 K6 L9 R13 Y20 H21 R22 R23 K29 A30 G33 K49 F50 Y51 D54 D55 K57 P58 R59 R64 K65 P66 K70 G86 R87 Q100 R118 R149 K151 K152 T153 T158 E159 G160 A169 T170 K171 N172 L173 K177	M1 A2 K6 L9 R13 Y20 H21 R22 R23 K29 A30 G33 K49 F50 Y51 D54 D55 K57 P58 R59 R64 K65 P66 K70 G86 R87 Q100 R118 R149 K151 K152 T153 T158 E159 G160 A169 T170 K171 N172 L173 K177

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4v7e, PDBe:4v7e, PDBj:4v7e
PDBsum	4v7e
PubMed	24499919
UniProt	Q5I7L4

[Back to BioLiP]