Structure of PDB 7ap5 Chain CCC

Receptor sequence
>7ap5CCC (length=164) Species: 2283151 (Nostoc sp. WR13) [Search protein sequence]
MKSVVTTVIAAADAAGRFPSSSDLESVQGSIQRAAARLEAAEKLAGNIDA
VATEAYNACIKKYPYLNNAGEANSTDTFKAKCARDIKHYLRLIQYCLVVG
GTGPLDEWGIAGQREVYRALGLPTAPYVEALSFARNRGCAPRDMSAQALT
EYNALLDYAINSLS
3D structure
PDB7ap5 The crystal stacks of hexameric assemblies of phycoerythrin from cyanobacterium Nostoc sp. WR13 resemble rods of phycobilisome
ChainCCC
Resolution2.131 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 PEB CCC A72 N73 F78 K81 C82 R84 D85 H88 W108 V116 Y117 L122 P126 Y127 A72 N73 F78 K81 C82 R84 D85 H88 W108 V116 Y117 L122 P126 Y127
BS02 PEB CCC N47 V51 E54 R137 C139 R142 D143 M144 N47 V51 E54 R137 C139 R142 D143 M144
BS03 PEB CCC L24 Q28 L24 Q28
BS04 PEB CCC R33 Q147 R33 Q147
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Sun Dec 1 12:16:47 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7ap5', asym_id = 'CCC', title = 'The crystal stacks of hexameric assemblies of ph...um Nostoc sp. WR13 resemble rods of phycobilisome'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7ap5', asym_id='CCC', title='The crystal stacks of hexameric assemblies of ph...um Nostoc sp. WR13 resemble rods of phycobilisome')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0015979,0030089', uniprot = '', pdbid = '7ap5', asym_id = 'CCC'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0015979,0030089', uniprot='', pdbid='7ap5', asym_id='CCC')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>