Structure of PDB 8b6g Chain CC |
>8b6gCC (length=59) Species: 5911 (Tetrahymena thermophila) [Search protein sequence] |
MRTKLYNAAYFLLNNNESFGHSFGIRLKIVGLNTWIVGYAVSRYYFSSLR VKAAQDERF |
|
PDB | 8b6g Structural basis of mitochondrial membrane bending by the I-II-III 2 -IV 2 supercomplex. |
Chain | CC |
Resolution | 3.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
UQ8 |
CC |
F19 S22 F23 R26 |
F19 S22 F23 R26 |
|
|
|