Structure of PDB 7zuw Chain CC

Receptor sequence
>7zuwCC (length=114) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
SGSSKNCNCQGTRHPVFDIAPNCLHCGKVVCVIEGLNKGKCGHCHEQLIS
DKAEENPELLAAQERLDRLLYFQDTSAERTKIIDNASDFDMNQEVGLWGS
ARERALALKKQQRN
3D structure
PDB7zuw Structural basis for clearing of ribosome collisions by the RQT complex.
ChainCC
Resolution4.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN CC C192 C195 C210 C213 C23 C26 C41 C44
BS02 ZN CC C178 H183 C200 C9 H14 C31
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0070530 K63-linked polyubiquitin modification-dependent protein binding
Biological Process
GO:0032790 ribosome disassembly
GO:0045893 positive regulation of DNA-templated transcription
GO:0072344 rescue of stalled ribosome
GO:1990116 ribosome-associated ubiquitin-dependent protein catabolic process
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol
GO:0022626 cytosolic ribosome
GO:0180022 RQC-trigger complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zuw, PDBe:7zuw, PDBj:7zuw
PDBsum7zuw
PubMed36801861
UniProtP36119|RQT4_YEAST RQC trigger complex subunit RQT4 (Gene Name=RQT4)

[Back to BioLiP]