Structure of PDB 4wqy Chain CC

Receptor sequence
>4wqyCC (length=137) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
HGKRYRALLEKVDPNKVYTIDEAARLVKELATAKFDETVEVHAKLGIDPR
RSDQNVRGTVSLPHGLGKAGRIEFRNDKTGAIHAPVGKASFPPEKLADNI
RAFIRALEAHKPEGAKGTFLRSVYVTTTMGPSVRINP
3D structure
PDB4wqy Conformational Changes of Elongation Factor G on the Ribosome during tRNA Translocation.
ChainCC
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna CC K6 H45 A46 K47 K71 R165 D167 K168 T169 A171 H173 P175 A205 K206 G207 S212 Y214 M219 K3 H42 A43 K44 K68 R75 D77 K78 T79 A81 H83 P85 A115 K116 G117 S122 Y124 M129
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
GO:0006417 regulation of translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4wqy, PDBe:4wqy, PDBj:4wqy
PDBsum4wqy
PubMed25594181
UniProtQ5SLP7|RL1_THET8 Large ribosomal subunit protein uL1 (Gene Name=rplA)

[Back to BioLiP]