Structure of PDB 8cre Chain CB

Receptor sequence

>8creCB (length=112) Species: 5476 (Candida albicans) [Search protein sequence]

AQRVTYRRRNPYNTRSNKIKVVKTPGGKLVAQHVKKAASRVKCGDCGSAL
AGISTLRPRQYAQVSKTHKTVQRAYGGSRCANCVKERIVRAFLIEEQKIV
KRVLKEQQDKEK

3D structure

PDB

8cre Drug-induced rotational movement of the ribosome is a key factor for read-through enhancement

Chain

Resolution

3.0 Å

3D
structure

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CB	A2 R4 V5 T6 Y7 R8 R9 R10 N11 P12 Y13 T15 R16 V22 V23 K24 T25 P26 G27 K29 K36 K37 S40 R41 V42 K43 A52 G53 I54 S55 T56 R58 P59 R60 Y62 Q64 S66 K67 T68 K70 T71 Q73 R74 Y76 G78 A82 N83 R88 R91 A92 I95 E96 K102	A1 R3 V4 T5 Y6 R7 R8 R9 N10 P11 Y12 T14 R15 V21 V22 K23 T24 P25 G26 K28 K35 K36 S39 R40 V41 K42 A51 G52 I53 S54 T55 R57 P58 R59 Y61 Q63 S65 K66 T67 K69 T70 Q72 R73 Y75 G77 A81 N82 R87 R90 A91 I94 E95 K101

External links