Structure of PDB 8bqs Chain CB

Receptor sequence

>8bqsCB (length=285) Species: 312017 (Tetrahymena thermophila SB210)

AESNDATSICLESISGTIKGLQKANYVVEHNPNLTSEEKKHLKQFLVYRY
NPADPHDQPKYVSYWCDIKKFPPMFLDAILYIKNELDPTLSIRRSCREGI
CGSCAVNCDGLHTLACISGFNRDLSKPTIITPLGHMFILKDLVVDMTNFY
AQYKMIEPYLKRKTPKPDANKEYPQSPEQRALLDGLYECVLCAACSTSCP
SYWWHPDRYLGPAILQQAYRWIVDSRDEYTQERIERIAEDVRLDDCQQIG
MCSFTCPKGLNPQLSLKNLMDMVKDFRQKRIEQEV

3D structure

• PDB: 8bqs Structural basis of mitochondrial membrane bending by I-II-III2-IV2 supercomplex
• Chain: CB
• Resolution: 2.9 Å

Enzymatic activity

• Enzyme Commision number: 1.3.5.1: succinate dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FES	CB	C122 R123 G125 C127 G128 C130 C142	C96 R97 G99 C101 G102 C104 C116
BS02	SF4	CB	C215 V216 L217 C218 A219 C221 A239 C282	C189 V190 L191 C192 A193 C195 A213 C256
BS03	F3S	CB	C225 C272 Q273 Q274 I275 G276 C278 Q289 L292	C199 C246 Q247 Q248 I249 G250 C252 Q263 L266
BS04	CA	CB	I248 D250 D253 T256	I222 D224 D227 T230

Gene Ontology

Molecular Function

• GO:0008177 succinate dehydrogenase (quinone) activity
• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0051536 iron-sulfur cluster binding
• GO:0051537 2 iron, 2 sulfur cluster binding
• GO:0051538 3 iron, 4 sulfur cluster binding

Biological Process

• GO:0006099 tricarboxylic acid cycle
• GO:0009060 aerobic respiration
• GO:0022904 respiratory electron transport chain

Cellular Component

• GO:0005743 mitochondrial inner membrane

External links

• PDB: RCSB:8bqs, PDBe:8bqs, PDBj:8bqs
• PDBsum: 8bqs
• UniProt: I7M403