Structure of PDB 8b6g Chain CB

Receptor sequence

>8b6gCB (length=285) Species: 5911 (Tetrahymena thermophila)

AESNDATSICLESISGTIKGLQKANYVVEHNPNLTSEEKKHLKQFLVYRY
NPADPHDQPKYVSYWCDIKKFPPMFLDAILYIKNELDPTLSIRRSCREGI
CGSCAVNCDGLHTLACISGFNRDLSKPTIITPLGHMFILKDLVVDMTNFY
AQYKMIEPYLKRKTPKPDANKEYPQSPEQRALLDGLYECVLCAACSTSCP
SYWWHPDRYLGPAILQQAYRWIVDSRDEYTQERIERIAEDVRLDDCQQIG
MCSFTCPKGLNPQLSLKNLMDMVKDFRQKRIEQEV

3D structure

• PDB: 8b6g Structural basis of mitochondrial membrane bending by the I-II-III 2 -IV 2 supercomplex.
• Chain: CB
• Resolution: 3.0 Å

Enzymatic activity

• Enzyme Commision number: 1.3.5.1: succinate dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FES	CB	C122 R123 G125 C127 G128 C130 C142	C96 R97 G99 C101 G102 C104 C116
BS02	SF4	CB	C215 L217 C218 C221 C282 K284	C189 L191 C192 C195 C256 K258
BS03	F3S	CB	C225 S227 C272 Q273 Q274 I275 G276 M277 C278	C199 S201 C246 Q247 Q248 I249 G250 M251 C252
BS04	CA	CB	I248 D250 D253 T256	I222 D224 D227 T230
BS05	UQ8	CB	P226 W230	P200 W204

Gene Ontology

Molecular Function

• GO:0008177 succinate dehydrogenase (quinone) activity
• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0051536 iron-sulfur cluster binding
• GO:0051537 2 iron, 2 sulfur cluster binding
• GO:0051538 3 iron, 4 sulfur cluster binding

Biological Process

• GO:0006099 tricarboxylic acid cycle
• GO:0009060 aerobic respiration
• GO:0022904 respiratory electron transport chain

Cellular Component

• GO:0005743 mitochondrial inner membrane

External links

• PDB: RCSB:8b6g, PDBe:8b6g, PDBj:8b6g
• PDBsum: 8b6g
• PubMed: 36949187
• UniProt: I7M403