Structure of PDB 5d8b Chain CB

Receptor sequence
>5d8bCB (length=147) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
MKKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGD
AIVPVEITIYADRSFTFVTKTPPASYLIRKAAGLEKGAHKPGREKVGRIT
WEQVLEIAKQKMPDLNTTDLEAAARMIAGSARSMGVEVVGAPEVKDA
3D structure
PDB5d8b Ribosome Structure Reveals Preservation of Active Sites in the Presence of a P-Site Wobble Mismatch.
ChainCB
Resolution3.63 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna CB V8 K9 L10 Q11 P25 Q29 P54 T71 S75 K86 H89 P91 K111 L115 N116 T117 T118 A122 R125 M126 G129 S133 M134 V8 K9 L10 Q11 P25 Q29 P54 T71 S75 K86 H89 P91 K111 L115 N116 T117 T118 A122 R125 M126 G129 S133 M134
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5d8b, PDBe:5d8b, PDBj:5d8b
PDBsum5d8b
PubMed26412335
UniProtQ5SLP6|RL11_THET8 Large ribosomal subunit protein uL11 (Gene Name=rplK)

[Back to BioLiP]