Structure of PDB 4ujc Chain CB

Receptor sequence

>4ujcCB (length=213) Species: 9986 (Oryctolagus cuniculus)

VVDPFSKKDWYDVKAPAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVS
LADLQNDEVAFRKFKLITEDVQGKNCLTNFHGMDLTRDKMCSMVKKWQTM
IEAHVDVKTTDGYLLRLFCVGFTKKRNNQIRKTSYAQHQQVRQIRKKMME
IMTREVQTNDLKEVVNKLIPDSIGKDIEKACQSIYPLHDVFVRKVKMLKK
PKFELGKLMELHG

3D structure

• PDB: 4ujc Structure of the Mammalian 80S Initiation Complex with Initiation Factor 5B on Hcv-Ires RNA.
• Chain: CB
• Resolution: 9.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CB	K56 V66 V114 K116 W117 H124 R136 F138 R146 N148 Q149 I150 R151 K152 Y155 Q157 H158 Q159 R165 K166 Q202 S203 I204 Y205 P206	K36 V46 V94 K96 W97 H104 R116 F118 R126 N128 Q129 I130 R131 K132 Y135 Q137 H138 Q139 R145 K146 Q182 S183 I184 Y185 P186

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Mar 7 15:30:23 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4ujc', asym_id = 'CB', title = 'Structure of the Mammalian 80S Initiation Complex with Initiation Factor 5B on Hcv-Ires RNA.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4ujc', asym_id='CB', title='Structure of the Mammalian 80S Initiation Complex with Initiation Factor 5B on Hcv-Ires RNA.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4ujc', asym_id = 'CB'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4ujc', asym_id='CB')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>