Structure of PDB 7wtn Chain CA

Receptor sequence
>7wtnCA (length=181) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
KFESRKIMVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTN
PKFTTDPGALQKGADFIKAFTLGFDLDDSIALLRLDDLYIETFEVKDVKT
LTGDHLSRAIGRIAGKDGKTKFAIENATRTRIVLADSKIHILGGFTHIRM
ARESVVSLILGSPPGKVYGNLRTVASRLKER
3D structure
PDB7wtn The nucleoplasmic phase of pre-40S formation prior to nuclear export.
ChainCA
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna CA H104 T107 H197 S199 R200 G203 R204 G207 K208 D209 G210 T212 G253 P256 K258 N262 H12 T15 H105 S107 R108 G111 R112 G115 K116 D117 G118 T120 G161 P164 K166 N170
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0042134 rRNA primary transcript binding
GO:0051082 unfolded protein binding
Biological Process
GO:0000056 ribosomal small subunit export from nucleus
GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000472 endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0042254 ribosome biogenesis
GO:0042255 ribosome assembly
GO:0043248 proteasome assembly
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0030686 90S preribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7wtn, PDBe:7wtn, PDBj:7wtn
PDBsum7wtn
PubMed36321656
UniProtQ99216|PNO1_YEAST Pre-rRNA-processing protein PNO1 (Gene Name=PNO1)

[Back to BioLiP]