Structure of PDB 7wtm Chain CA

Receptor sequence
>7wtmCA (length=181) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
KFESRKIMVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTN
PKFTTDPGALQKGADFIKAFTLGFDLDDSIALLRLDDLYIETFEVKDVKT
LTGDHLSRAIGRIAGKDGKTKFAIENATRTRIVLADSKIHILGGFTHIRM
ARESVVSLILGSPPGKVYGNLRTVASRLKER
3D structure
PDB7wtm In vitro structural maturation of an early stage pre-40S particle coupled with U3 snoRNA release and central pseudoknot formation.
ChainCA
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna CA H197 S199 R200 G203 G207 D209 G210 K213 L226 G253 P256 K258 N262 R269 H105 S107 R108 G111 G115 D117 G118 K121 L134 G161 P164 K166 N170 R177
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0042134 rRNA primary transcript binding
GO:0051082 unfolded protein binding
Biological Process
GO:0000056 ribosomal small subunit export from nucleus
GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000472 endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0042254 ribosome biogenesis
GO:0042255 ribosome assembly
GO:0043248 proteasome assembly
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0030686 90S preribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7wtm, PDBe:7wtm, PDBj:7wtm
PDBsum7wtm
PubMed36263816
UniProtQ99216|PNO1_YEAST Pre-rRNA-processing protein PNO1 (Gene Name=PNO1)

[Back to BioLiP]