Structure of PDB 6boh Chain CA

Receptor sequence

>6bohCA (length=59) Species: 262724 (Thermus thermophilus HB27)

AKHPVPKKKTSKARRDARRSHHALTPPILVPCPECKAMKPPHTVCPECGY
YAGRKVLEV

3D structure

• PDB: 6boh Conformational Control of Translation Termination on the 70S Ribosome.
• Chain: CA
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CA	A2 K3 H4 P5 V6 P7 K8 K9 K10 T11 S12 K13 A14 R15 R16 R19 R20 S21 H22 H23 I29 P42 H43 Y52 A53	A1 K2 H3 P4 V5 P6 K7 K8 K9 T10 S11 K12 A13 R14 R15 R18 R19 S20 H21 H22 I28 P41 H42 Y51 A52
BS02	ZN	CA	C36 C49	C35 C48

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6boh, PDBe:6boh, PDBj:6boh
• PDBsum: 6boh
• PubMed: 29731232
• UniProt: P62652|RL32_THET2 Large ribosomal subunit protein bL32 (Gene Name=rpmF)