Structure of PDB 4v7e Chain CA

Receptor sequence

>4v7eCA (length=255) Species: 4565 (Triticum aestivum) [Search protein sequence]

MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTDIIH
DPGRGAPLAKVTFRHPFRYKHQKELFVAAEGMYTGQFVYCGRRATLSIGN
VLPIRSVPEGAVVCNVEHHVGDRGVFARASGDYAIVISHNPDNGTSRIKL
PSGAKKIVPSSCRAMIGQVAGGGRTEKPMLKAGNAYHKYRVKRNCWPKVR
GVAMNPVEHPHGGGNHQHIGHASTVRRDAPPGQKVGLIAARRTGRLRGQA
AATAA

3D structure

PDB

4v7e Structures of the Sec61 complex engaged in nascent peptide translocation or membrane insertion.

Chain

Resolution

5.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CA	I137 R147 K149 L246 R247 Q249 A254 A255	I137 R147 K149 L246 R247 Q249 A254 A255
BS02	rna	CA	M1 G2 R3 I5 R6 A7 Q8 R9 K10 G11 S14 V15 K17 T20 H21 R23 G25 R28 D33 F34 R37 N38 G39 Y40 K42 H50 R54 R64 H65 P66 F67 R68 Y69 F87 R93 H118 H119 G121 R123 G124 V125 F126 R128 A129 S130 G131 D132 K156 G173 R174 T175 K177 P178 M179 L180 K181 A182 A185 H187 K188 R190 R193 N194 C195 W196 P197 K198 V199 R200 G201 V202 M204 N205 P206 V207 H209 G212 G213 G214 N215 H216 Q217 H218 I219 G220 H221 A222 S223 T224 V225 R226 R227 P230 P231 G232 Q233 K234 A239 A240 R241 R242 T243 G244	M1 G2 R3 I5 R6 A7 Q8 R9 K10 G11 S14 V15 K17 T20 H21 R23 G25 R28 D33 F34 R37 N38 G39 Y40 K42 H50 R54 R64 H65 P66 F67 R68 Y69 F87 R93 H118 H119 G121 R123 G124 V125 F126 R128 A129 S130 G131 D132 K156 G173 R174 T175 K177 P178 M179 L180 K181 A182 A185 H187 K188 R190 R193 N194 C195 W196 P197 K198 V199 R200 G201 V202 M204 N205 P206 V207 H209 G212 G213 G214 N215 H216 Q217 H218 I219 G220 H221 A222 S223 T224 V225 R226 R227 P230 P231 G232 Q233 K234 A239 A240 R241 R242 T243 G244

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3
Tue Dec 3 00:37:29 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

/var/www/html/BioLiP/pdb.cgi in <module>()

1443 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

1444 else:

=> 1445 pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

1446

1447 uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v7e', asym_id = 'CA', title = 'Structures of the Sec61 complex engaged in nascent peptide translocation or membrane insertion.'

/var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v7e', asym_id='CA', title='Structures of the Sec61 complex engaged in nascent peptide translocation or membrane insertion.')

839

840 if go:

=> 841 display_go(go,uniprot,pdbid,asym_id)

842 return pubmed,uniprot

843

global display_go = <function display_go>, go = '0003723,0003735,0005840,0006412,0015934', uniprot = '', pdbid = '4v7e', asym_id = 'CA'

/var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0003735,0005840,0006412,0015934', uniprot='', pdbid='4v7e', asym_id='CA')

480 '''.replace("$namespace_link",namespace_link

481 ).replace("$namespace",namespace

=> 482 ).replace("$uniprot",u

483 ))

484 for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
args = ("local variable 'u' referenced before assignment",)
with_traceback = <built-in method with_traceback of UnboundLocalError object>