Structure of PDB 4u52 Chain C9

Receptor sequence

>4u52C9 (length=143) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

PGVSVRDVAAQDFINAYASFLQRQGKLEVPGYVDIVKTSSGNEMPPQDAE
GWFYKRAASVARHIYMRKQVGVGKLNKLYGGAKSRGVRPYKHIDASGSIN
RKVLQALEKIGIVEISPKGGRRISENGQRDLDRIAAQTLEEDE

3D structure

PDB

4u52 ?

Chain

Resolution

3.0 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C9	P2 G3 V4 R7 Q12 V37 K38 T39 S41 N43 E44 M45 Q48 R57 S60 R63 H64 R68 K69 G72 V73 G74 K75 K78 L79 G82 A83 K84 R86 G87 V88 R89 P90 Y91 K92 H93 S97 G98 S99 R102 Q106 K119 G121 R122 Q129 R130 D133	P1 G2 V3 R6 Q11 V36 K37 T38 S40 N42 E43 M44 Q47 R56 S59 R62 H63 R67 K68 G71 V72 G73 K74 K77 L78 G81 A82 K83 R85 G86 V87 R88 P89 Y90 K91 H92 S96 G97 S98 R101 Q105 K118 G120 R121 Q128 R129 D132

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0000054	ribosomal subunit export from nucleus
GO:0006412	translation
GO:0042254	ribosome biogenesis
GO:0042274	ribosomal small subunit biogenesis

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4u52, PDBe:4u52, PDBj:4u52
PDBsum	4u52
PubMed	25209664
UniProt	P07280\|RS19A_YEAST Small ribosomal subunit protein eS19A (Gene Name=RPS19A)