Structure of PDB 4v8e Chain C6

Receptor sequence
>4v8eC6 (length=45) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
LLLECTECKRRNYATEKNKRNTPNKLELRKYCPWCRKHTVHREVK
3D structure
PDB4v8e A new understanding of the decoding principle on the ribosome.
ChainC6
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna C6 T23 E24 K25 K27 R28 R37 K38 Y39 C40 W42 K45 H46 T15 E16 K17 K19 R20 R29 K30 Y31 C32 W34 K37 H38
BS02 OHX C6 T23 E24 T15 E16
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v8e, PDBe:4v8e, PDBj:4v8e
PDBsum4v8e
PubMed22437501
UniProtP35871|RL33_THET8 Large ribosomal subunit protein bL33 (Gene Name=rpmG)

[Back to BioLiP]