Structure of PDB 5m1j Chain C5

Receptor sequence

>5m1jC5 (length=361) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

SRPQVTVHSLTGEATANALPLPAVFSAPIRPDIVHTVFTSVNKNKRQAYA
VSEKAGHQTSAESWGTGRAVARIPRVGGGGTGRSGQGAFGNMCRGGRMFA
PTKTWRKWNVKVNHNEKRYATASAIAATAVASLVLARGHRVEKIPEIPLV
VSTDLESIQKTKEAVAALKAVGAHSDLLKVLKSKKLRAGKGKYRNRRWTQ
RRGPLVVYAEDNGIVKALRNVPGVETANVASLNLLQLAPGAHLGRFVIWT
EAAFTKLDQVWGSETVASSKVGYTLPSHIISTSDVTRIINSSEIQSAIRP
AGQATQKRTHVLKKNPLKNKQVLLRLNPYAKVFAAEKLGSKKAEKTGTKP
AAVFTETLKHD

3D structure

PDB

5m1j Structural insights into ribosomal rescue by Dom34 and Hbs1 at near-atomic resolution.

Chain

Resolution

3.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	C5	H36 T40 K44 N45 R47 Q48 Y50 V52 S53 A56 G57 H58 Q59 T60 S61 T67 G68 A70 V71 A72 R73 I74 P75 G80 G81 T82 R84 Q87 F90 N92 M93 R95 R98 M99 F100 A101 P102 K104 W106 R107 K108 K112 V113 N114 H115 N116 E117 K118 R119 R138 K161 T162 K163 L179 K180 S184 K186 L187 R188 A189 G190 K191 K193 Y194 R195 N196 R197 R198 W199 R202 R203 Y209 V216 K217 R220 N221 P223 T227 A231 S232 N234 P240 G241 H243 K271 V272 T287 I290 N291 R300 A305 Q307 K308 R309 T310 V312 L313 K315 N316 L318 N320 Q322 R326 A331 F334 S341 K342 K343 T347 T349 P351 L359	H35 T39 K43 N44 R46 Q47 Y49 V51 S52 A55 G56 H57 Q58 T59 S60 T66 G67 A69 V70 A71 R72 I73 P74 G79 G80 T81 R83 Q86 F89 N91 M92 R94 R97 M98 F99 A100 P101 K103 W105 R106 K107 K111 V112 N113 H114 N115 E116 K117 R118 R137 K160 T161 K162 L178 K179 S183 K185 L186 R187 A188 G189 K190 K192 Y193 R194 N195 R196 R197 W198 R201 R202 Y208 V215 K216 R219 N220 P222 T226 A230 S231 N233 P239 G240 H242 K270 V271 T286 I289 N290 R299 A304 Q306 K307 R308 T309 V311 L312 K314 N315 L317 N319 Q321 R325 A330 F333 S340 K341 K342 T346 T348 P350 L358
BS02	rna	C5	A49 A51 T105 Y194	A48 A50 T104 Y193
BS03	MG	C5	G88 C94 R95	G87 C93 R94
BS04	MG	C5	T162 K163	T161 K162
BS05	MG	C5	N229 S232	N228 S231
BS06	MG	C5	Q48 A49	Q47 A48

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5m1j, PDBe:5m1j, PDBj:5m1j
PDBsum	5m1j
PubMed	27995908
UniProt	P10664\|RL4A_YEAST Large ribosomal subunit protein uL4A (Gene Name=RPL4A)

[Back to BioLiP]