Structure of PDB 5fci Chain C5

Receptor sequence

>5fciC5 (length=124) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

KKRVFKTHSYRGVDLEKLLEMSTEDFVKLAPARVRRRFARGMTSKPAGFM
KKLRAAKLAAPENEKPAPVRTHMRNMIIVPEMIGSVVGIYNGKAFNQVEI
RPEMLGHYLGEFSITYTPVRHGRA

3D structure

PDB

5fci ?

Chain

Resolution

3.4 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	C5	R18 P38 A39 R40 R42 R43 R44 R47 K59 R77 H79 R81 N82 Y97 G99 K100 F102 Y115 E118 T122 T124 V126 R127 H128 G129	R11 P31 A32 R33 R35 R36 R37 R40 K52 R70 H72 R74 N75 Y90 G92 K93 F95 Y108 E111 T115 T117 V119 R120 H121 G122
BS02	rna	C5	P75 Q104	P68 Q97
BS03	OHX	C5	A67 E69	A60 E62

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0000054	ribosomal subunit export from nucleus
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:5fci, PDBe:5fci, PDBj:5fci
PDBsum	5fci
PubMed	26906928
UniProt	Q01855\|RS15_YEAST Small ribosomal subunit protein uS19 (Gene Name=RPS15)