Structure of PDB 5e81 Chain C5

Receptor sequence
>5e81C5 (length=104) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
RVKMHVKKGDTVLVASGKYKGRVGKVKEVLPKKYAVIVEGVNIVKKAVRV
SPKYPQGGFIEKEAPLHASKVRPICPACGKPTRVRKKFLENGKKIRVCAK
CGGA
3D structure
PDB5e81 Novel base-pairing interactions at the tRNA wobble position crucial for accurate reading of the genetic code.
ChainC5
Resolution2.95 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna C5 K4 H6 K8 K9 S17 G18 K19 E29 V30 P32 I44 V45 K46 K47 V49 K54 F60 H68 S70 K71 R73 K81 T83 R84 V85 R86 K3 H5 K7 K8 S16 G17 K18 E28 V29 P31 I43 V44 K45 K46 V48 K53 F59 H67 S69 K70 R72 K80 T82 R83 V84 R85
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5e81, PDBe:5e81, PDBj:5e81
PDBsum5e81
PubMed26791911
UniProtQ5SHP9|RL24_THET8 Large ribosomal subunit protein uL24 (Gene Name=rplX)

[Back to BioLiP]