Structure of PDB 4wzo Chain C5

Receptor sequence
>4wzoC5 (length=104) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
RVKMHVKKGDTVLVASGKYKGRVGKVKEVLPKKYAVIVEGVNIVKKAVRV
SPKYPQGGFIEKEAPLHASKVRPICPACGKPTRVRKKFLENGKKIRVCAK
CGGA
3D structure
PDB4wzo Structural insights into the translational infidelity mechanism.
ChainC5
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna C5 R2 K4 K8 K9 S17 G18 K19 V30 P32 I44 V45 K46 K47 V49 K54 F60 H68 S70 K71 R73 T83 V85 N92 V98 R1 K3 K7 K8 S16 G17 K18 V29 P31 I43 V44 K45 K46 V48 K53 F59 H67 S69 K70 R72 T82 V84 N91 V97
BS02 MG C5 E91 N92 E90 N91
BS03 ZN C5 C79 A100 C78 A99
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4wzo, PDBe:4wzo, PDBj:4wzo
PDBsum4wzo
PubMed26037619
UniProtQ5SHP9|RL24_THET8 Large ribosomal subunit protein uL24 (Gene Name=rplX)

[Back to BioLiP]