Structure of PDB 4u4o Chain C5

Receptor sequence

>4u4oC5 (length=124) Species: 559292 (Saccharomyces cerevisiae S288C)

KKRVFKTHSYRGVDLEKLLEMSTEDFVKLAPARVRRRFARGMTSKPAGFM
KKLRAAKLAAPENEKPAPVRTHMRNMIIVPEMIGSVVGIYNGKAFNQVEI
RPEMLGHYLGEFSITYTPVRHGRA

3D structure

• PDB: 4u4o ?
• Chain: C5
• Resolution: 3.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C5	R18 P38 A39 R40 R42 R43 R44 R47 R77 H79 R81 N82 Y97 G99 K100 F102 Y115 E118 T122 T124 V126 H128	R11 P31 A32 R33 R35 R36 R37 R40 R70 H72 R74 N75 Y90 G92 K93 F95 Y108 E111 T115 T117 V119 H121
BS02	rna	C5	A74 P75 R77 Q104	A67 P68 R70 Q97
BS03	OHX	C5	L65 A66 A67 E69	L58 A59 A60 E62

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0000054 ribosomal subunit export from nucleus
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4u4o, PDBe:4u4o, PDBj:4u4o
• PDBsum: 4u4o
• PubMed: 25209664
• UniProt: Q01855|RS15_YEAST Small ribosomal subunit protein uS19 (Gene Name=RPS15)