Structure of PDB 5lyb Chain C3

Receptor sequence

>5lybC3 (length=150) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

GRMHSAGKGISSSAIPYSRNAPAWFKLSSESVIEQIVKYARKGLTPSQIG
VLLRDAHGVTQARVITGNKIMRILKSNGLAPEIPEDLYYLIKKAVSVRKH
LERNRKDKDAKFRLILIESRIHRLARYYRTVAVLPPNWKYESATASALVN

3D structure

PDB

5lyb ?

Chain

Resolution

3.25 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	C3	G2 R3 M4 H5 K9 G10 I11 S12 S13 S14 A15 P17 R20 P47 S48 G51 V52 R55 T61 R64 K70 M72 R73 D87 Y90 K94 H101 R104 N105 K107 D108 D110 F113 R114 I116 L117 S120 R121 R124 Y128	G1 R2 M3 H4 K8 G9 I10 S11 S12 S13 A14 P16 R19 P46 S47 G50 V51 R54 T60 R63 K69 M71 R72 D86 Y89 K93 H100 R103 N104 K106 D107 D109 F112 R113 I115 L116 S119 R120 R123 Y127
BS02	rna	C3	H123 K140	H122 K139
BS03	OHX	C3	S12 S13	S11 S12

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0070181	small ribosomal subunit rRNA binding

	Biological Process
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:0030686	90S preribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5lyb, PDBe:5lyb, PDBj:5lyb
PDBsum	5lyb
PubMed	27827794
UniProt	P05756\|RS13_YEAST Small ribosomal subunit protein uS15 (Gene Name=RPS13)

[Back to BioLiP]