Structure of PDB 4v9q Chain C3

Receptor sequence
>4v9qC3 (length=44) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
LLLECTECKRRNYATEKNKRNTPNKLELRKYCPWCRKHTVHREV
3D structure
PDB4v9q Blasticidin S inhibits translation by trapping deformed tRNA on the ribosome.
ChainC3
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna C3 R19 E24 K25 K27 T30 N32 E35 R37 K38 Y39 W42 K45 H46 R11 E16 K17 K19 T22 N24 E27 R29 K30 Y31 W34 K37 H38
BS02 MG C3 Y39 C40 Y31 C32
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v9q, PDBe:4v9q, PDBj:4v9q
PDBsum4v9q
PubMed23824292
UniProtQ72GW3|RL33_THET2 Large ribosomal subunit protein bL33 (Gene Name=rpmG)

[Back to BioLiP]