Structure of PDB 7zqd Chain C2

Receptor sequence
>7zqdC2 (length=80) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]
AHIVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKASQMASAPRTEDCVGC
KRCETACPTDFLSVRVYLGSESTRSMGLSY
3D structure
PDB7zqd Algal photosystem I dimer and high-resolution model of PSI-plastocyanin complex.
ChainC2
Resolution2.97 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 1.97.1.12: photosystem I.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SF4 C2 C21 P22 V25 C48 V49 G50 C51 K52 R53 C54 V67 C20 P21 V24 C47 V48 G49 C50 K51 R52 C53 V66
BS02 SF4 C2 C11 I12 C14 T15 C17 A40 C58 P59 S64 V65 C10 I11 C13 T14 C16 A39 C57 P58 S63 V64
Gene Ontology
Molecular Function
GO:0009055 electron transfer activity
GO:0016491 oxidoreductase activity
GO:0046872 metal ion binding
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0009773 photosynthetic electron transport in photosystem I
GO:0015979 photosynthesis
Cellular Component
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zqd, PDBe:7zqd, PDBj:7zqd
PDBsum7zqd
PubMed36229605
UniProtQ00914|PSAC_CHLRE Photosystem I iron-sulfur center (Gene Name=psaC)

[Back to BioLiP]