Structure of PDB 7miz Chain C2

Receptor sequence

>7mizC2 (length=428) Species: 5811 (Toxoplasma gondii)

MREVISIHVGQAGIQIGNACWELFCLEHGIQPDGQMPDAFNTFFSETGAG
KHVPRCVFLDLEPTVVDEVRTGTYRHLFHPEQLISGKEDAANNFARGHYT
IGKEIVDLSLDRIRKLADNCTGLQGFLMFNAVGGGTGSGLGCLLLERLSV
DYGKKSKLNFCSWPSPQVSTAVVEPYNSVLSTHSLLEHTDVAVMLDNEAI
YDICRRNLDIERPTYTNLNRLIAQVISSLTASLRFDGALNVDVTEFQTNL
VPYPRIHFMLSSYAPIISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRH
GKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQP
PTVVPGGDLAKVMRAVCMISNSTAIAEVFSRMDHKFDLMYAKRAFVHWYV
GEGMEEGEFSEAREDLAALEKDYEEVGI

3D structure

• PDB: 7miz Cryo-EM structure of cortical microtubules from human parasite Toxoplasma gondii identifies their microtubule inner proteins.
• Chain: C2
• Resolution: 3.4 Å

Enzymatic activity

• Enzyme Commision number: 3.6.5.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	C2	N18 A19 L26 G29 E77 V78 T80 T82 T225 P364	N18 A19 L26 G29 E68 V69 T71 T73 T216 P355
BS02	GTP	C2	G10 Q11 A12 Q15 E71 N101 A140 G143 G144 T145 G146 T179 N206 Y224 N228	G10 Q11 A12 Q15 E62 N92 A131 G134 G135 T136 G137 T170 N197 Y215 N219
BS03	MG	C2	Q11 E71 T145	Q11 E62 T136

Gene Ontology

Molecular Function

• GO:0005200 structural constituent of cytoskeleton
• GO:0005525 GTP binding
• GO:0016787 hydrolase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0000226 microtubule cytoskeleton organization
• GO:0000278 mitotic cell cycle
• GO:0007017 microtubule-based process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005856 cytoskeleton
• GO:0005874 microtubule

External links

• PDB: RCSB:7miz, PDBe:7miz, PDBj:7miz
• PDBsum: 7miz
• PubMed: 34031406
• UniProt: P10873|TBA_TOXGO Tubulin alpha chain