Structure of PDB 6tcl Chain C2

Receptor sequence
>6tclC2 (length=80) Species: 103690 (Nostoc sp. PCC 7120 = FACHB-418) [Search protein sequence]
SHTVKIYDTCIGCTQCVRACPTDVLEMVPWDGCKAAQVASSPRTEDCVGC
KRCETACPTDFLSIRVYLGAETTRSMGLAY
3D structure
PDB6tcl Distinct structural modulation of photosystem I and lipid environment stabilizes its tetrameric assembly.
ChainC2
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 1.97.1.12: photosystem I.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SF4 C2 C21 P22 V25 C48 V49 G50 C51 K52 R53 C54 C20 P21 V24 C47 V48 G49 C50 K51 R52 C53
BS02 SF4 C2 C11 G13 C14 C17 C58 S64 C10 G12 C13 C16 C57 S63
Gene Ontology
Molecular Function
GO:0009055 electron transfer activity
GO:0016491 oxidoreductase activity
GO:0046872 metal ion binding
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0009773 photosynthetic electron transport in photosystem I
GO:0015979 photosynthesis
Cellular Component
GO:0009522 photosystem I
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6tcl, PDBe:6tcl, PDBj:6tcl
PDBsum6tcl
PubMed32170279
UniProtP0A410|PSAC_NOSS1 Photosystem I iron-sulfur center (Gene Name=psaC)

[Back to BioLiP]