Structure of PDB 6gzz Chain C2

Receptor sequence

>6gzzC2 (length=272) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

AVKKFKPYTPSRRFMTVADFSEITKTEPEKSLVKPLKKTGGRNNQGRITV
RFRGGGHKRLYRIIDFKRWDKVGIPAKVAAIEYDPNRSARIALLHYVDGE
KRYIIAPDGLQVGQQVVAGPDAPIQVGNALPLRFIPVGTVVHAVELEPKK
GAKLARAAGTSAQIQGREGDYVILRLPSGELRKVHGECYATVGAVGNADH
KNIVLGKAGRSRWLGRRPHVRGAAMNPVDHPHGGGEGRAPRGRPPASPWG
WQTKGLKTRKRRKPSSRFIIAR

3D structure

PDB

6gzz Cryo-EM structure of the hibernating Thermus thermophilus 100S ribosome reveals a protein-mediated dimerization mechanism.

Chain

Resolution

4.13 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C2	Y9 T10 S12 R13 R14 F15 F21 E30 K31 S32 V34 K38 K39 G41 G42 R43 N44 N45 G47 R48 I49 T50 R52 R54 H58 K59 L61 Y62 R63 K68 W70 K78 Y84 P86 R88 H96 Y97 V98 D99 E148 K151 L155 R157 A158 A159 L177 P178 S179 E181 V205 L206 G207 K208 A209 R211 R213 W214 R218 P219 H220 R222 G223 A225 M226 P228 G234 G235 G236 E237 G238 R239 A240 P241 R242 G243 R244 P246 A247 S248 P249 W250 Q253 T254 K255 G256 L257 K258 T259 R260 K261 R262 R263 R268 F269 I270 R273	Y8 T9 S11 R12 R13 F14 F20 E29 K30 S31 V33 K37 K38 G40 G41 R42 N43 N44 G46 R47 I48 T49 R51 R53 H57 K58 L60 Y61 R62 K67 W69 K77 Y83 P85 R87 H95 Y96 V97 D98 E147 K150 L154 R156 A157 A158 L176 P177 S178 E180 V204 L205 G206 K207 A208 R210 R212 W213 R217 P218 H219 R221 G222 A224 M225 P227 G233 G234 G235 E236 G237 R238 A239 P240 R241 G242 R243 P245 A246 S247 P248 W249 Q252 T253 K254 G255 L256 K257 T258 R259 K260 R261 R262 R267 F268 I269 R272

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0016740	transferase activity
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6gzz, PDBe:6gzz, PDBj:6gzz
PDBsum	6gzz
PubMed	30301898
UniProt	P60405\|RL2_THET8 Large ribosomal subunit protein uL2 (Gene Name=rplB)

[Back to BioLiP]