Structure of PDB 8xxn Chain C1 |
>8xxnC1 (length=90) Species: 9606 (Homo sapiens) [Search protein sequence] |
PAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTV IEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF |
|
PDB | 8xxn Human tumor suppressor PDCD4 directly interacts with ribosomes to repress translation. |
Chain | C1 |
Resolution | 3.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
C1 |
K64 A68 C69 N70 |
K41 A45 C46 N47 |
|
|
|
|