Structure of PDB 8rcs Chain C1

Receptor sequence

>8rcsC1 (length=213) Species: 562 (Escherichia coli) [Search protein sequence]

GQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQYLTKELAKAS
VSRIVIERPAKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQI
NIAEVRKPELDAKLVADSITSQLERRVMFRRAMKRAVQNAMRLGAKGIKV
EVSGRLGGAEIARTEWYREGRVPLHTLRADIDYNTSEAHTTYGVIGVKVW
IFKGEILGGMAAV

3D structure

PDB

8rcs Transient disome complex formation in native polysomes during ongoing protein synthesis captured by cryo-EM.

Chain

Resolution

4.46 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C1	G2 Q3 K4 V5 R127 S154 G155 R156 E161 W167 R169 R172 V173 P174 L175 H176 T177 L178 R179 H190 T192 Y193 G194 V195 K199	G1 Q2 K3 V4 R126 S153 G154 R155 E160 W166 R168 R171 V172 P173 L174 H175 T176 L177 R178 H189 T191 Y192 G193 V194 K198
BS02	rna	C1	M129 R131 R132 R164	M128 R130 R131 R163

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8rcs, PDBe:8rcs, PDBj:8rcs
PDBsum	8rcs
PubMed	38409277
UniProt	P0A7V3\|RS3_ECOLI Small ribosomal subunit protein uS3 (Gene Name=rpsC)

[Back to BioLiP]