Structure of PDB 7ls1 Chain C1

Receptor sequence

>7ls1C1 (length=190) Species: 10090 (Mus musculus) [Search protein sequence]

MKTILSNQTVDIPENVEITLKGRTVIVKGPRGTLRRDFNHINVELSLLGK
KKKRLRVDKWWGNRKELATVRTICSHVQNMIKGVTLGFRYKMRSVYAHFP
INVVIQENGSLVEIRNFLGEKYIRRVRMRTGVACSVSQAQKDELILEGND
IELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQA

3D structure

PDB

7ls1 Functionally distinct roles for eEF2K in the control of ribosome availability and p-body abundance.

Chain

Resolution

3.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C1	K21 R23 H40 N42 V43 K50 K59 W60 R64 K65 A68 R71 T72 S75 H76 H98 F99 E120 K121 Y122 R129 I151 S155 N156 Q163 K170 D171 I172 R173 K174 F175	K21 R23 H40 N42 V43 K50 K59 W60 R64 K65 A68 R71 T72 S75 H76 H98 F99 E120 K121 Y122 R129 I151 S155 N156 Q163 K170 D171 I172 R173 K174 F175

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0140236	translation at presynapse
GO:0140242	translation at postsynapse

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0045202	synapse
GO:0098793	presynapse
GO:0098794	postsynapse
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7ls1, PDBe:7ls1, PDBj:7ls1
PDBsum	7ls1
PubMed	34815424
UniProt	P51410\|RL9_MOUSE Large ribosomal subunit protein uL6 (Gene Name=Rpl9)

[Back to BioLiP]