Structure of PDB 4u4z Chain C0

Receptor sequence
>4u4zC0 (length=96) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
MLMPKEDRNKIHQYLFQEGVVVAKKDFNQAKHEEIDTKNLYVIKALQSLT
SKGYVKTQFSWQYYYYTLTEEGVEYLREYLNLPEHIVPATYIQERN
3D structure
PDB4u4z ?
ChainC0
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna C0 M1 L2 M3 K5 K25 F27 N28 L40 K44 Q47 S48 S51 F59 Y64 M1 L2 M3 K5 K25 F27 N28 L40 K44 Q47 S48 S51 F59 Y64
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0000054 ribosomal subunit export from nucleus
GO:0002181 cytoplasmic translation
GO:0034198 cellular response to amino acid starvation
GO:0045860 positive regulation of protein kinase activity
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4u4z, PDBe:4u4z, PDBj:4u4z
PDBsum4u4z
PubMed25209664
UniProtQ08745|RS10A_YEAST Small ribosomal subunit protein eS10A (Gene Name=RPS10A)

[Back to BioLiP]