Structure of PDB 9avw Chain C

Receptor sequence

>9avwC (length=31) Species: 9606 (Homo sapiens)

DEGAQWNCTACTFLNHPALIRCEQCEMPRHF

3D structure

• PDB: 9avw Structure of TAB2 NZF domain bound to K6 / Lys6-linked diubiquitin
• Chain: C
• Resolution: 1.747 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	C	C670 C673 C684 C687	C8 C11 C22 C25

External links

• PDB: RCSB:9avw, PDBe:9avw, PDBj:9avw
• PDBsum: 9avw
• UniProt: Q9NYJ8|TAB2_HUMAN TGF-beta-activated kinase 1 and MAP3K7-binding protein 2 (Gene Name=TAB2)