Structure of PDB 9avt Chain C

Receptor sequence

>9avtC (length=30) Species: 9606 (Homo sapiens)

EGAQWNCTACTFLNHPALIRCEQCEMPRHF

3D structure

• PDB: 9avt Structure of TAB2 NZF domain bound to K6 / Lys6-linked diubiquitin
• Chain: C
• Resolution: 1.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	C	C670 C673 C684 C687	C7 C10 C21 C24

External links

• PDB: RCSB:9avt, PDBe:9avt, PDBj:9avt
• PDBsum: 9avt
• UniProt: Q9NYJ8|TAB2_HUMAN TGF-beta-activated kinase 1 and MAP3K7-binding protein 2 (Gene Name=TAB2)