Structure of PDB 8ybk Chain C

Receptor sequence

>8ybkC (length=99) Species: 9606 (Homo sapiens)

ARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVL

3D structure

• PDB: 8ybk Cryo-EM structure and biochemical analyses of the nucleosome containing the cancer-associated histone H3 mutation E97K.
• Chain: C
• Resolution: 2.69 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	C	T16 R17 R32	T7 R8 R23
BS02	dna	C	R11 K13 R29 R42 V43 G44	R2 K4 R20 R33 V34 G35

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0005515 protein binding
• GO:0031492 nucleosomal DNA binding

Biological Process

• GO:0006325 chromatin organization
• GO:0008285 negative regulation of cell population proliferation
• GO:0031507 heterochromatin formation
• GO:0061644 protein localization to CENP-A containing chromatin

Cellular Component

• GO:0000786 nucleosome
• GO:0005634 nucleus
• GO:0005694 chromosome
• GO:0043505 CENP-A containing nucleosome
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:8ybk, PDBe:8ybk, PDBj:8ybk
• PDBsum: 8ybk
• PubMed: 38972377
• UniProt: P04908|H2A1B_HUMAN Histone H2A type 1-B/E (Gene Name=H2AC4)