Structure of PDB 8wmj Chain C

Receptor sequence

>8wmjC (length=80) Species: 52970 (Rhodomonas salina)

SHSVKVYDTCIGCTQCVRACPCDVLEMVSWDGCKAGQIASAPRTEDCIGC
KRCETACPTDFLSVRVYLGGETTRSMGLAY

3D structure

• PDB: 8wmj Growth phase-dependent reorganization of cryptophyte photosystem I antennae.
• Chain: C
• Resolution: 3.0 Å

Enzymatic activity

• Enzyme Commision number: 1.97.1.12: photosystem I.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	C	C21 P22 V25 C48 I49 G50 C51 K52 C54 V67	C20 P21 V24 C47 I48 G49 C50 K51 C53 V66
BS02	SF4	C	C11 I12 C14 T15 C17 C58 P59 S64	C10 I11 C13 T14 C16 C57 P58 S63

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0015979 photosynthesis

Cellular Component

• GO:0009507 chloroplast
• GO:0009522 photosystem I
• GO:0009535 chloroplast thylakoid membrane
• GO:0009579 thylakoid
• GO:0016020 membrane

External links

• PDB: RCSB:8wmj, PDBe:8wmj, PDBj:8wmj
• PDBsum: 8wmj
• PubMed: 38734819
• UniProt: A6MVS8|PSAC_RHDSA Photosystem I iron-sulfur center (Gene Name=psaC)