Structure of PDB 8wgh Chain C

Receptor sequence

>8wghC (length=80) Species: 141305 (Fittonia albivenis)

SHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGCKAKQIASAPRTEDCVGC
KRCESACPTDFLSVRVYLWHETTRSMGLAY

3D structure

• PDB: 8wgh Cryo-EM structure of the red-shifted Fittonia albivenis PSI-LHCI
• Chain: C
• Resolution: 2.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	C	C21 P22 C48 V49 G50 C51 C54 V67	C20 P21 C47 V48 G49 C50 C53 V66
BS02	SF4	C	C11 I12 C14 Q16 C17 C58 P59 S64	C10 I11 C13 Q15 C16 C57 P58 S63

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0015979 photosynthesis

Cellular Component

• GO:0009507 chloroplast
• GO:0009522 photosystem I
• GO:0009534 chloroplast thylakoid
• GO:0009535 chloroplast thylakoid membrane
• GO:0009579 thylakoid
• GO:0016020 membrane

External links

• PDB: RCSB:8wgh, PDBe:8wgh, PDBj:8wgh
• PDBsum: 8wgh
• PubMed: 39060282
• UniProt: A4QJG7|PSAC_AETCO Photosystem I iron-sulfur center (Gene Name=psaC)