Structure of PDB 8wdv Chain C

Receptor sequence

>8wdvC (length=311) Species: 572477 (Allochromatium vinosum DSM 180)

CERPPPEVVQKGYRGVAMEQNYNPRLLEASIKANLPVESLPAAAPGGPSV
SDVYENVQVLKDLSVAEFTRTMVAVTTWVAPKEGCNYCHVPGNWASDDIY
TKVVSRRMFELVRATNSNWKDHVAETGVTCYTCHRGNPVPKYVWVTDPGP
NQPSGVTPTGQNYASSTVAYSALPLDPYTPFLDQSNEIRVIGQTALPAGN
TTSLKQAEWTYGLMMQISDSLGVNCTFCHNSRSFYDWKQSTPQRTTAWYA
IRHVRDINQNYIWPLNDALPASRKGPYGDPFKVGCMTCHQGAYKPLYGAQ
MAKDYPALYES

3D structure

• PDB: 8wdv High-resolution structure and biochemical properties of the LH1-RC photocomplex from the model purple sulfur bacterium, Allochromatium vinosum
• Chain: C
• Resolution: 2.24 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	C	Y76 E77 N78 V79 Q80 V81 F90 M94 T98 C107 C110 H111 W116 A117 K124 S127 R128	Y54 E55 N56 V57 Q58 V59 F68 M72 T76 C85 C88 H89 W94 A95 K102 S105 R106
BS02	HEM	C	V101 Y109 Y122 V126 M130 F131 V134 C152 C155 H156 P160 V161 P162 R295 F303 V305	V79 Y87 Y100 V104 M108 F109 V112 C130 C133 H134 P138 V139 P140 R273 F281 V283
BS03	HEM	C	I210 R211 V212 I213 T232 M236 I239 C247 C250 H251 F256 Y257 R266 A269 W270 R274	I188 R189 V190 I191 T210 M214 I217 C225 C228 H229 F234 Y235 R244 A247 W248 R252
BS04	HEM	C	H144 V145 T148 V150 L243 Q265 T268 A272 V276 C307 C310 H311 Y315 K316 P317	H122 V123 T126 V128 L221 Q243 T246 A250 V254 C285 C288 H289 Y293 K294 P295
BS05	MG	C	Q183 E230	Q161 E208
BS06	Z41	C	C23 E24	C1 E2

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding

Biological Process

• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0030077 plasma membrane light-harvesting complex

External links

• PDB: RCSB:8wdv, PDBe:8wdv, PDBj:8wdv
• PDBsum: 8wdv
• PubMed: 38347078
• UniProt: O82947|CYCR_ALLVD Photosynthetic reaction center cytochrome c subunit (Gene Name=pufC)