Structure of PDB 8vre Chain C

Receptor sequence

>8vreC (length=276) Species: 9606 (Homo sapiens)

FQSMSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSALRK
MGVKLTPHNKETVQHSDVLFLAVKPHIIPFILDEIGADIEDRHIVVSCAA
GVTISSIEKKLSAFRPAPRVIRCMTNTPVVVREGATVYATGTHAQVEDGR
LMEQLLSSVGFCTEVEEDLIDAVTGLSGSGPAYAFTALDALADGGVKMGL
PRRLAVRLGAQALLGAAKMLLHSEQHPGQLKDNVSSPGGATIHALHVLES
GGFRSLLINAVEASCIRTRELQSMAD

3D structure

• PDB: 8vre Screening a knowledge-based library of low molecular weight compounds against the proline biosynthetic enzyme 1-pyrroline-5-carboxylate 1 (PYCR1)
• Chain: C
• Resolution: 1.83 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAI	C	G7 A8 G9 Q10 L11 P35 N56 A69 V70 K71 I78 C95 A96 A97 M121 T124	G10 A11 G12 Q13 L14 P38 N59 A72 V73 K74 I81 C98 A99 A100 M124 T127
BS02	FPK	C	V231 S233 G236 A237 T238	V234 S236 G239 A240 T241
BS03	FPK	C	T171 G175	T174 G178

Gene Ontology

Molecular Function

• GO:0004735 pyrroline-5-carboxylate reductase activity
• GO:0005515 protein binding
• GO:0016491 oxidoreductase activity
• GO:0042802 identical protein binding

Biological Process

• GO:0006561 proline biosynthetic process
• GO:0034599 cellular response to oxidative stress
• GO:0051881 regulation of mitochondrial membrane potential
• GO:0055129 L-proline biosynthetic process
• GO:1903377 negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

Cellular Component

• GO:0005739 mitochondrion
• GO:0005759 mitochondrial matrix

External links

• PDB: RCSB:8vre, PDBe:8vre, PDBj:8vre
• PDBsum: 8vre
• PubMed: 39133178
• UniProt: P32322|P5CR1_HUMAN Pyrroline-5-carboxylate reductase 1, mitochondrial (Gene Name=PYCR1)