Structure of PDB 8v87 Chain C

Receptor sequence

>8v87C (length=358) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence]

RPQVTVHSLTGEATANALPLPAVFSAPIRPDIVHTVFTSVNKNKRQAYAV
SEKAGHQTSAESWGTGRAVARIPRVGGGGTGRSGQGAFGNMCRGGRMFAP
TKTWRKWNVKVNHNEKRYATASAIAATAVASLVLARGHRVEKIPEIPLVV
STDLESIQKTKEAVAALKAVGAHSDLLKVLKSKKLRAGKGKYRNRRWTQR
RGPLVVYAEDNGIVKALRNVPGVETANVASLNLLQLAPGAHLGRFVIWTE
AAFTKLDQVWGSETVASSKVGYTLPSHIISTSDVTRIINSSEIQSAIRPA
GQATQKRTHVLKKNPLKNKQVLLRLNPYAKVFAAEKLGSKKAEKTGTKPA
AVFTETLK

3D structure

PDB

8v87 The DEAD-box ATPase Dbp10/DDX54 initiates peptidyl transferase center formation during 60S ribosome biogenesis.

Chain

Resolution

2.66 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	R31 I34 H36 K44 N45 K46 R47 Q48 Y50 V52 S53 A56 H58 Q59 T60 S61 A70 V71 A72 R73 P75 G81 T82 R84 Q87 N92 M93 R95 G96 R98 M99 F100 A101 P102 K104 W106 R107 K108 K112 N114 H115 N116 E117 K118 R119 R138 R141 T162 K180 K183 S184 K186 L187 R188 A189 G190 K191 Y194 R195 R197 W199 R202 R203 Y209 K217 R220 N221 T227 S232 N234 P240 G241 H243 K271 V272 R300 A302 G303 Q304 A305 T306 Q307 K308 R309 H311 V312 L313 K315 K319 N320 Q322 L324 R326 N328 A331 K332 F334 A335 G340 S341 K342 K343 A344 T347 T349 P351 L359 K360	R29 I32 H34 K42 N43 K44 R45 Q46 Y48 V50 S51 A54 H56 Q57 T58 S59 A68 V69 A70 R71 P73 G79 T80 R82 Q85 N90 M91 R93 G94 R96 M97 F98 A99 P100 K102 W104 R105 K106 K110 N112 H113 N114 E115 K116 R117 R136 R139 T160 K178 K181 S182 K184 L185 R186 A187 G188 K189 Y192 R193 R195 W197 R200 R201 Y207 K215 R218 N219 T225 S230 N232 P238 G239 H241 K269 V270 R298 A300 G301 Q302 A303 T304 Q305 K306 R307 H309 V310 L311 K313 K317 N318 Q320 L322 R324 N326 A329 K330 F332 A333 G338 S339 K340 K341 A342 T345 T347 P349 L357 K358
BS02	rna	C	A49 A51 K193 Y194	A47 A49 K191 Y192

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8v87, PDBe:8v87, PDBj:8v87
PDBsum	8v87
PubMed	38632236
UniProt	P10664\|RL4A_YEAST Large ribosomal subunit protein uL4A (Gene Name=RPL4A)

[Back to BioLiP]