Structure of PDB 8v84 Chain C

Receptor sequence

>8v84C (length=343) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence]

SRPQVTVHSLTGEATANALPLPAVFSAPIRPDIVHTVFTSVNKNKRQAYA
VSEKAGHQTSAESWGTGRAVARIPRVGGGGTGRSGQGAFGNMCRGGRMFA
PTKTWRKWNVKVNHNEKRYATASAIAATAVASLVLARGHRVEKIPEIPLV
VSTDLESIQKTKEAVAALKAVGAHSDLLKVLKSKKLRAGKGKYRNRRWTQ
RRGPLVVYAEDNGIVKALRNVPGVETANVASLNLLQLAPGAHLGRFVIWT
EAAFTKLDQVWGSETVASSKVGYTLPSHIISTSDVTRIINSSEIQSAIRP
AGQATQKRTHVLKKNPLKNKQVLLRLNPYAKVFAAEKLGSKKA

3D structure

PDB

8v84 The DEAD-box ATPase Dbp10/DDX54 initiates peptidyl transferase center formation during 60S ribosome biogenesis.

Chain

Resolution

2.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	R31 I34 H36 T40 V42 N43 K44 N45 K46 R47 Q48 Y50 V52 S53 A56 Q59 T60 S61 V71 R73 P75 G80 G81 T82 R84 Q87 N92 M93 R95 G96 R98 M99 F100 A101 K104 W106 R107 K108 K112 V113 N114 H115 N116 E117 K118 R119 R138 R141 K161 T162 L179 K180 K183 S184 K186 L187 R188 A189 G190 K191 K193 Y194 R195 R197 W199 R202 R203 Y209 K217 R220 N221 T227 S232 N234 P240 G241 H243 K271 V272 N291 Q296 R300 A302 G303 Q304 A305 T306 Q307 K308 R309 T310 V312 L313 K315 K319 N320 Q322 R326 A331 K332 F334 A335 S341 K342 K343 A344	R30 I33 H35 T39 V41 N42 K43 N44 K45 R46 Q47 Y49 V51 S52 A55 Q58 T59 S60 V70 R72 P74 G79 G80 T81 R83 Q86 N91 M92 R94 G95 R97 M98 F99 A100 K103 W105 R106 K107 K111 V112 N113 H114 N115 E116 K117 R118 R137 R140 K160 T161 L178 K179 K182 S183 K185 L186 R187 A188 G189 K190 K192 Y193 R194 R196 W198 R201 R202 Y208 K216 R219 N220 T226 S231 N233 P239 G240 H242 K270 V271 N290 Q295 R299 A301 G302 Q303 A304 T305 Q306 K307 R308 T309 V311 L312 K314 K318 N319 Q321 R325 A330 K331 F333 A334 S340 K341 K342 A343
BS02	rna	C	A49 A51 K193 Y194	A48 A50 K192 Y193

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8v84, PDBe:8v84, PDBj:8v84
PDBsum	8v84
PubMed	38632236
UniProt	P10664\|RL4A_YEAST Large ribosomal subunit protein uL4A (Gene Name=RPL4A)

[Back to BioLiP]