Structure of PDB 8v15 Chain C

Receptor sequence

>8v15C (length=271) Species: 9606 (Homo sapiens)

KLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQD
LPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLL
LRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADV
MADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSL
EVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVES
LVELLGWTEEMRDLVQRETGK

3D structure

• PDB: 8v15 Computationally Driven Discovery and Characterization of SIRT3 Activating Compounds that Fully Recover Catalytic Activity under NAD+ Depletion
• Chain: C
• Resolution: 2.4 Å

Enzymatic activity

• Enzyme Commision number: 2.3.1.286: protein acetyllysine N-acetyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	C	F180 H248 V292 F294 G295 E296 P297 L298 V324	F58 H126 V170 F172 G173 E174 P175 L176 V202
BS02	ZN	C	C256 C259 C280 C283	C134 C137 C158 C161
BS03	Y4T	C	R158 E177 Q228 S321 L322 E323 V324	R37 E55 Q106 S199 L200 E201 V202
BS04	CNA	C	G145 A146 G147 D156 Q228 N229 H248 G319 N344 R345 D346 V366	G24 A25 G26 D35 Q106 N107 H126 G197 N222 R223 D224 V244

Gene Ontology

Molecular Function

• GO:0017136 NAD-dependent histone deacetylase activity
• GO:0051287 NAD binding
• GO:0070403 NAD+ binding

External links

• PDB: RCSB:8v15, PDBe:8v15, PDBj:8v15
• PDBsum: 8v15
• UniProt: Q9NTG7|SIR3_HUMAN NAD-dependent protein deacetylase sirtuin-3, mitochondrial (Gene Name=SIRT3)