Structure of PDB 8ux1 Chain C

Receptor sequence
>8ux1C (length=107) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
KAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEV
LELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQ
AVLLPKK
3D structure
PDB8ux1 Cryo-EM structure of Ran bound to RCC1 and the nucleosome core particle
ChainC
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C K15 R17 R32 R42 K3 R5 R20 R30
BS02 dna C R29 R42 V43 G44 A45 K75 T76 R77 R17 R30 V31 G32 A33 K63 T64 R65
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
GO:0007526 larval somatic muscle development
GO:0031507 heterochromatin formation
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005700 polytene chromosome
GO:0005704 polytene chromosome band

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ux1, PDBe:8ux1, PDBj:8ux1
PDBsum8ux1
PubMed
UniProtP84051|H2A_DROME Histone H2A (Gene Name=His2A)

[Back to BioLiP]