Structure of PDB 8ur0 Chain C

Receptor sequence
>8ur0C (length=66) Species: 562 (Escherichia coli) [Search protein sequence]
FCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAI
KRARYLSLLPYTDRHQ
3D structure
PDB8ur0 Escherichia coli transcription-translation coupled complex class A (TTC-A) containing RfaH bound to ops signal, mRNA with a 21 nt long spacer, and fMet-tRNAs in E-site and P-site of the ribosome
ChainC
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna C K38 I39 P41 S42 R48 K50 Q52 R53 K60 R63 Y64 Y70 H74 K29 I30 P32 S33 R39 K41 Q43 R44 K51 R54 Y55 Y61 H65
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ur0, PDBe:8ur0, PDBj:8ur0
PDBsum8ur0
PubMed39117885
UniProtA0A0E2KXL3

[Back to BioLiP]