Structure of PDB 8uq7 Chain C |
>8uq7C (length=75) Species: 9606 (Homo sapiens) [Search protein sequence] |
SVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKI GSLDNITHVPGGGNKKIETHKLTFR |
|
PDB | 8uq7 Alzheimer's disease PHF complexed with PET ligand MK-6240 |
Chain | C |
Resolution | 2.31 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
X6R |
C |
K353 I360 |
K49 I56 |
|
|
|