Structure of PDB 8u86 Chain C

Receptor sequence

>8u86C (length=446) Species: 9606 (Homo sapiens) [Search protein sequence]

TRAYWHNHRSQLFCLATYAGLHVLLFGLAASAHRDLGASVMVAKGCGQCL
NFDCSFIAVLMLRRCLTWLRATWLAQVLPLDQNIQFHQLMGYVVVGLSLV
HTVAHTVNFVLQAQGSASPTGVALLLLLLLMFICSSSCIRRSGHFEVFYW
THLSYLLVWLLLIFHGPNFWKWLLVPGILFFLEKAIGLAVSRMAAVCIME
VNLLPSKVTHLLIKRPPFFHYRPGDYLYLNIPTIARYEWHPFTISSAPEQ
KDTIWLHIRSQGQWTNRLYESFKACNIKCYIDGPYGTPTRRIFASEHAVL
IGAGIGITPFASILQSIMYRHQKRKHTCPSCQHSWIEGVQDNMKLHKVDF
IWINRDQRSFEWFVSLLTKLEMDQAEEAQYGRFLELHMYMTSATQPGRPD
WSKVFQKVAAEKKGKVQVFFCGSPALAKVLKGHCEKFGFRFFQENF

3D structure

PDB

8u86 Structural Basis of Human NOX5 Activation

Chain

Resolution

3.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

1.6.3.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	HEB	C	K225 G228 L231 N232 S279 H282 T283 H286 G325 V326 L329 L332 L366 H369 P371	K44 G47 L50 N51 S98 H101 T102 H105 G121 V122 L125 L128 L162 H165 P167
BS02	HEB	C	I238 M242 H268 G272 M335 F336 F352 H356 Y359 K388	I57 M61 H87 G91 M131 F132 F148 H152 Y155 K184
BS03	NDP	C	N188 H189 A543 N594 R595 T631 R671 W674 S696 L699	N7 H8 A303 N354 R355 T391 R398 W401 S423 L426
BS04	FAD	C	R344 Y430 H444 P445 F446 T447 H461 R463 Q465 G466 Q467 W468 T469	R140 Y226 H240 P241 F242 T243 H257 R259 Q261 G262 Q263 W264 T265

Gene Ontology

	Molecular Function
GO:0005509	calcium ion binding
GO:0015252	proton channel activity
GO:0016175	superoxide-generating NAD(P)H oxidase activity
GO:0016491	oxidoreductase activity
GO:0020037	heme binding
GO:0046872	metal ion binding
GO:0050660	flavin adenine dinucleotide binding
GO:0050661	NADP binding
GO:0050664	oxidoreductase activity, acting on NAD(P)H, oxygen as acceptor
GO:0106292	superoxide-generating NADPH oxidase activity

	Biological Process
GO:0001525	angiogenesis
GO:0001819	positive regulation of cytokine production
GO:0001935	endothelial cell proliferation
GO:0006915	apoptotic process
GO:0006952	defense response
GO:0034220	monoatomic ion transmembrane transport
GO:0042554	superoxide anion generation
GO:0043012	regulation of fusion of sperm to egg plasma membrane
GO:0061640	cytoskeleton-dependent cytokinesis
GO:1902600	proton transmembrane transport

	Cellular Component
GO:0005783	endoplasmic reticulum
GO:0005789	endoplasmic reticulum membrane
GO:0005886	plasma membrane
GO:0043020	NADPH oxidase complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8u86, PDBe:8u86, PDBj:8u86
PDBsum	8u86
PubMed
UniProt	Q96PH1\|NOX5_HUMAN NADPH oxidase 5 (Gene Name=NOX5)

[Back to BioLiP]