Structure of PDB 8ttl Chain C

Receptor sequence

>8ttlC (length=90) Species: 9606 (Homo sapiens)

QSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVS
GDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQG

3D structure

• PDB: 8ttl Structures of AT8 and PHF1 phosphomimetic tau: Insights into the posttranslational modification code of tau aggregation.
• Chain: C
• Resolution: 2.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	C	H388 E391	H38 E41

External links

• PDB: RCSB:8ttl, PDBe:8ttl, PDBj:8ttl
• PDBsum: 8ttl
• PubMed: 38408247
• UniProt: P10636|TAU_HUMAN Microtubule-associated protein tau (Gene Name=MAPT)