Structure of PDB 8tnr Chain C

Receptor sequence
>8tnrC (length=35) Species: 9606,83333 [Search protein sequence]
LLFCPICGFTCRQKGNLLRHINLHTGEKLFKYHLY
3D structure
PDB8tnr Continuous evolution of compact protein degradation tags regulated by selective molecular glues
ChainC
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 MIQ C F18 C19 I21 C22 F3 C4 I6 C7
BS02 ZN C C19 C22 H35 H39 C4 C7 H20 H24
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0015144 carbohydrate transmembrane transporter activity
GO:1901982 maltose binding
Biological Process
GO:0006974 DNA damage response
GO:0008643 carbohydrate transport
GO:0015768 maltose transport
GO:0034219 carbohydrate transmembrane transport
GO:0034289 detection of maltose stimulus
GO:0042956 maltodextrin transmembrane transport
GO:0055085 transmembrane transport
GO:0060326 cell chemotaxis
Cellular Component
GO:0016020 membrane
GO:0030288 outer membrane-bounded periplasmic space
GO:0042597 periplasmic space
GO:0043190 ATP-binding cassette (ABC) transporter complex
GO:0055052 ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing
GO:1990060 maltose transport complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8tnr, PDBe:8tnr, PDBj:8tnr
PDBsum8tnr
PubMed38484051
UniProtP0AEX9|MALE_ECOLI Maltose/maltodextrin-binding periplasmic protein (Gene Name=malE);
Q13422|IKZF1_HUMAN DNA-binding protein Ikaros (Gene Name=IKZF1)

[Back to BioLiP]