Structure of PDB 8tnp Chain C

Receptor sequence

LFCPICGFTCRQKGNLLRHINLHTGEKLFKYHL

3D structure

PDB

8tnp Continuous evolution of compact protein degradation tags regulated by selective molecular glues

Chain

Resolution

3.3 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	Y70	C	C19 C22 G23	C3 C6 G7
BS02	ZN	C	C19 C22 H35 H39	C3 C6 H19 H23

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0015144	carbohydrate transmembrane transporter activity
GO:1901982	maltose binding

	Biological Process
GO:0006974	DNA damage response
GO:0008643	carbohydrate transport
GO:0015768	maltose transport
GO:0034219	carbohydrate transmembrane transport
GO:0034289	detection of maltose stimulus
GO:0042956	maltodextrin transmembrane transport
GO:0055085	transmembrane transport
GO:0060326	cell chemotaxis

	Cellular Component
GO:0016020	membrane
GO:0030288	outer membrane-bounded periplasmic space
GO:0042597	periplasmic space
GO:0043190	ATP-binding cassette (ABC) transporter complex
GO:0055052	ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing
GO:1990060	maltose transport complex

External links

PDB	RCSB:8tnp, PDBe:8tnp, PDBj:8tnp
PDBsum	8tnp
PubMed	38484051
UniProt	P0AEX9\|MALE_ECOLI Maltose/maltodextrin-binding periplasmic protein (Gene Name=malE); Q13422\|IKZF1_HUMAN DNA-binding protein Ikaros (Gene Name=IKZF1)