Structure of PDB 8ti1 Chain C

Receptor sequence

>8ti1C (length=321) Species: 10116 (Rattus norvegicus) [Search protein sequence]

RARFVSKKGNCNVAHKNIRERGRFLQDVFTTLVDLKWPHTLLIFTMSFLC
SWLLFAMVWWLIAFAHGDLAPGEGTNVPCVTSIHSFSSAFLFSIEVQVTI
GFGGRMVTEECPLAILILIVQNIVGLMINAIMLGCIFMKTAQAHRRAETL
IFSKHAVITLRHGRLCFMLRVGDLRKSMIISATIHMQVVRKTTSPEGEVV
PLHQVDIPMENGVGGNSIFLVAPLIIYHVIDSNSPLYDLAPSDLHHHQDL
EIIVILEGVVETTGITTQARTSYLADEILWGQRFVPIVAEEDGRYSVDYS
KFGNTVKVPTPLCTARQLDED

3D structure

PDB

8ti1 Structure of an open K ATP channel reveals tandem PIP 2 binding sites mediating the Kir6.2 and SUR1 regulatory interface.

Chain

Resolution

2.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PT5	C	I93 M158	I62 M127
BS02	PT5	C	L56 L85 M163	L25 L54 M132

Gene Ontology

	Molecular Function
GO:0005242	inward rectifier potassium channel activity
GO:0005249	voltage-gated potassium channel activity
GO:0005515	protein binding
GO:0005524	ATP binding
GO:0015272	ATP-activated inward rectifier potassium channel activity
GO:0019829	ATPase-coupled monoatomic cation transmembrane transporter activity
GO:0030506	ankyrin binding
GO:0031072	heat shock protein binding
GO:0044325	transmembrane transporter binding
GO:0099508	voltage-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential

	Biological Process
GO:0001508	action potential
GO:0001666	response to hypoxia
GO:0002931	response to ischemia
GO:0003229	ventricular cardiac muscle tissue development
GO:0006006	glucose metabolic process
GO:0006813	potassium ion transport
GO:0006915	apoptotic process
GO:0006950	response to stress
GO:0008340	determination of adult lifespan
GO:0009410	response to xenobiotic stimulus
GO:0031669	cellular response to nutrient levels
GO:0032355	response to estradiol
GO:0033198	response to ATP
GO:0033574	response to testosterone
GO:0034220	monoatomic ion transmembrane transport
GO:0034765	regulation of monoatomic ion transmembrane transport
GO:0042391	regulation of membrane potential
GO:0046676	negative regulation of insulin secretion
GO:0050796	regulation of insulin secretion
GO:0050877	nervous system process
GO:0061762	CAMKK-AMPK signaling cascade
GO:0071316	cellular response to nicotine
GO:0071333	cellular response to glucose stimulus
GO:0071356	cellular response to tumor necrosis factor
GO:0071805	potassium ion transmembrane transport
GO:0098662	inorganic cation transmembrane transport
GO:0099505	regulation of presynaptic membrane potential
GO:1903078	positive regulation of protein localization to plasma membrane
GO:1904638	response to resveratrol
GO:1990573	potassium ion import across plasma membrane

	Cellular Component
GO:0001669	acrosomal vesicle
GO:0005635	nuclear envelope
GO:0005737	cytoplasm
GO:0005768	endosome
GO:0005886	plasma membrane
GO:0008282	inward rectifying potassium channel
GO:0014704	intercalated disc
GO:0016020	membrane
GO:0030315	T-tubule
GO:0030673	axolemma
GO:0034702	monoatomic ion channel complex
GO:0042383	sarcolemma
GO:0042734	presynaptic membrane
GO:0043025	neuronal cell body
GO:0070852	cell body fiber
GO:0098978	glutamatergic synapse

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ti1, PDBe:8ti1, PDBj:8ti1
PDBsum	8ti1
PubMed	38509107
UniProt	P70673\|KCJ11_RAT ATP-sensitive inward rectifier potassium channel 11 (Gene Name=Kcnj11)

[Back to BioLiP]