Structure of PDB 8tgt Chain C |
>8tgtC (length=70) Species: 9606 (Homo sapiens) [Search protein sequence] |
LKYTCLYVRSTIYKRCRHPGELRNGQVEIKTDLSFGSQIEFSCSEGFFLI GSTTSRCEVVGWSHPLPQCE |
|
PDB | 8tgt Structure of human C4b-binding protein alpha chain CCP domains 1 and 2 in complex with the hypervariable region of group A Streptococcus M68 protein |
Chain | C |
Resolution | 2.5 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
C |
G95 F96 |
G46 F47 |
|
|
|